Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.4 M

Registered domains

9.2 M

New domains in the last 30 days

64.9 M

Social media profiles detected

zoomedu.net

zoomedu.net serves a website of its own. It answers on both IPv4 and IPv6, with no TLS certificate and MX records for mail.

19,764 other domains share an IP address with it.

The most recent crawl returned the page title “Checking your browser before accessing. Just a moment...” and 5,768 bytes of HTML. webXtrend first recorded it on .

Domain properties

Property Value Explanation
First seen 5/15/2014 Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record yes The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https no The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate no certificate Shows whether the domain has a valid SSL certificate.
Redirects 0 Number of domains that redirect to this domain.
Reverse IP 19,764 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

Title Checking your browser before accessing. Just a moment...
Description (not set)
Content-Length 5,768 bytes

Title and description as published by the page itself in its own <title> and <meta name="description"> tags.

Last SSL certificate

No certificate data available for this domain.

DNS history

IPv4 address Last updated
92.113.16.100 10/3/2026
92.113.23.206 10/3/2026
92.113.16.45 9/24/2026
92.113.23.244 9/24/2026
92.113.16.30 9/16/2026
IPv6 address Last updated
2a02:4780:42:835:5897:33c:47db:4bc0 10/3/2026
2a02:4780:43:d2e1:fd9e:6cbd:1eb4:cd54 10/3/2026
2a02:4780:43:b5fb:172:ed66:cc56:2213 9/24/2026
2a02:4780:44:9e28:8c20:88cf:2af7:673a 9/24/2026
2a02:4780:42:2224:6da0:7c6f:5e69:d602 9/16/2026
Mail server Priority Last updated
mx1.hostinger.com 5 2/3/2026
mx2.hostinger.com 10 2/3/2026
Name server Last updated
ns1.dns-parking.com 2/3/2026
ns2.dns-parking.com 2/3/2026

Last 5 redirect domains

No domains found.

Reverse IP neighbours

92.113.23.162 9,919 domains · here since 10/3/2026
Domain On this IP since
zzpslim.nl 9/28/2026
zzhostingpicks.com 10/2/2026
zyrondesign.com.br 9/22/2026
zyraiptv.com 9/26/2026
zynquestraintelligence.com 9/28/2026
zwitchoriginals.com 9/23/2026
zukrhub.com 9/24/2026
zpad.in 9/30/2026
zos.com.sa 10/2/2026
zorvaniqsaltlakecityappliancerepairservice.site 9/22/2026
zooyos.com 9/24/2026
zoomyourweb3.com 9/25/2026
and 9,906 more
92.113.16.10 9,843 domains · here since 10/3/2026
Domain On this IP since
zzstockloans.com 9/30/2026
zzsecurities.com 9/24/2026
zzautosales.com 10/1/2026
zyvoracare.com 9/22/2026
zyonstudio.com.br 9/24/2026
zynexsolutions.site 10/3/2026
zynaflo.com 9/25/2026
zygo.bot 9/25/2026
zyfario.in 9/23/2026
zvdent.com 10/2/2026
zuz-mat.com 9/30/2026
zurichinfotech.in 9/28/2026
and 9,830 more
2a02:4780:42:c6db:57d2:3efc:901b:a7 1 domain · here since 10/3/2026
Domain On this IP since
No other domains on this address.
2a02:4780:43:9faf:40ab:18de:edd4:896a 1 domain · here since 10/3/2026
Domain On this IP since
No other domains on this address.

Sharing an address does not always mean sharing a server: on a CDN or a large hosting platform, millions of unrelated domains answer on the same few addresses. We measured how far that goes in Half the web sits on 276 IP addresses.