Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.2 M

Registered domains

9.0 M

New domains in the last 30 days

65.3 M

Social media profiles detected

zuchka.org

Domain properties

Property Value Explanation
First seen 6/13/2026 Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record no The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https no The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate no certificate Shows whether the domain has a valid SSL certificate.
Redirects 0 Number of domains that redirect to this domain.
Reverse IP 19,715 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

Title Checking your browser before accessing. Just a moment...
Description (not set)
Content-Length 6,192 bytes

Title and description as published by the page itself in its own <title> and <meta name="description"> tags.

Last SSL certificate

No certificate data available for this domain.

DNS history

Last 5 redirect domains

No domains found.

Reverse IP neighbours

92.113.16.186 9,926 domains · here since 9/21/2026
Domain On this IP since
zyronixsports.com 9/19/2026
zyracloudadvisory.co.uk 9/18/2026
zyntolabs.io 9/18/2026
zynexx.com 9/24/2026
zynewmaterial.com 9/26/2026
zygointeriors.com 9/25/2026
zyan-fashion.com 9/24/2026
zweb.live 9/18/2026
zvwash.pro 9/23/2026
zukpack.com 9/26/2026
zukep.com 9/27/2026
zubicad.com 9/24/2026
and 9,913 more
92.113.23.162 9,787 domains · here since 9/21/2026
Domain On this IP since
zzpslim.nl 9/28/2026
zyrondesign.com.br 9/22/2026
zyraiptv.com 9/26/2026
zynquestraintelligence.com 9/28/2026
zxracing.shop 9/19/2026
zwitchoriginals.com 9/23/2026
zuriride.com 9/21/2026
zumeirah.com 9/19/2026
zukrhub.com 9/24/2026
zpad.in 9/30/2026
zovixfilms.com 9/19/2026
zorvaniqsaltlakecityappliancerepairservice.site 9/22/2026
and 9,774 more
2a02:4780:43:dc46:8143:faf5:ac5e:154d 1 domain · here since 9/21/2026
Domain On this IP since
No other domains on this address.
2a02:4780:45:79a3:e9a4:17f6:2e2f:5b8e 1 domain · here since 9/21/2026
Domain On this IP since
No other domains on this address.