Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.3 M

Registered domains

9.2 M

New domains in the last 30 days

65.3 M

Social media profiles detected

zephit.com

zephit.com serves a website of its own over HTTPS. It answers on both IPv4 and IPv6, with a valid TLS certificate and MX records for mail.

19,665 other domains share an IP address with it.

The most recent crawl returned the page title “Default page” and 16,369 bytes of HTML. webXtrend first recorded it on .

Domain properties

Property Value Explanation
First seen 4/19/2015 Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record yes The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https yes The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate valid Shows whether the domain has a valid SSL certificate.
Redirects 0 Number of domains that redirect to this domain.
Reverse IP 19,665 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

Title Default page
Description Default page
Content-Length 16,369 bytes

Title and description as published by the page itself in its own <title> and <meta name="description"> tags.

Last SSL certificate

Issuer Let's Encrypt
Valid from 8/11/2026
Valid to 11/9/2026
Time until expiry 38 days

DNS history

IPv4 address Last updated
92.113.16.252 10/2/2026
92.113.23.85 10/2/2026
92.113.16.197 9/23/2026
92.113.23.73 9/23/2026
92.113.16.33 9/15/2026
IPv6 address Last updated
2a02:4780:43:ec7d:e246:118d:38a2:fe62 10/2/2026
2a02:4780:45:a96e:1b16:ba27:1ef0:a894 10/2/2026
2a02:4780:43:732:c4e4:1782:bc26:99e1 9/23/2026
2a02:4780:44:6cf2:b507:d3d0:2162:dde 9/23/2026
2a02:4780:42:776:b95c:831a:8561:a4a8 9/15/2026
Mail server Priority Last updated
mx1.titan.email 10 2/15/2024
mx2.titan.email 20 2/15/2024
Name server Last updated
ns1.dns-parking.com 2/15/2024
ns2.dns-parking.com 2/15/2024
ns1.bluehost.com 12/6/2023
ns2.bluehost.com 12/6/2023

Last 5 redirect domains

No domains found.

Reverse IP neighbours

92.113.23.162 9,892 domains · here since 10/1/2026
Domain On this IP since
zzpslim.nl 9/28/2026
zyrondesign.com.br 9/22/2026
zyraiptv.com 9/26/2026
zynquestraintelligence.com 9/28/2026
zwitchoriginals.com 9/23/2026
zuriride.com 9/21/2026
zukrhub.com 9/24/2026
zuchka.org 9/21/2026
zpad.in 9/30/2026
zorvaniqsaltlakecityappliancerepairservice.site 9/22/2026
zooyos.com 9/24/2026
zoomyourweb3.com 9/25/2026
and 9,879 more
92.113.16.132 9,771 domains · here since 10/1/2026
Domain On this IP since
zzrshop.com 9/29/2026
zyrl.io 9/29/2026
zyrexion.es 10/2/2026
zynorahealth.online 10/2/2026
zynofit.com 9/20/2026
zviadi.online 9/23/2026
zv25a.com 9/27/2026
zuruckzumursprungandreasgoldemann.de 9/28/2026
zumzumsportcompany.com 9/27/2026
zugiut.org.il 9/23/2026
zrydez.com 9/22/2026
zplovecherish-wedding.com 9/20/2026
and 9,758 more
2a02:4780:42:7cd4:4afc:518c:8376:364c 1 domain · here since 10/1/2026
Domain On this IP since
No other domains on this address.
2a02:4780:45:abf4:c871:7343:aba1:fb48 1 domain · here since 10/1/2026
Domain On this IP since
No other domains on this address.

Sharing an address does not always mean sharing a server: on a CDN or a large hosting platform, millions of unrelated domains answer on the same few addresses. We measured how far that goes in Half the web sits on 276 IP addresses.