Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.5 M

Registered domains

9.2 M

New domains in the last 30 days

64.8 M

Social media profiles detected

motionyoga.co.uk

motionyoga.co.uk serves a website of its own. It answers on both IPv4 and IPv6, with no TLS certificate.

629 other domains share an IP address with it, and one domain redirects to it.

webXtrend first recorded it on .

Domain properties

Property Value Explanation
First seen 4/10/2016 Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record no The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https no The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate no certificate Shows whether the domain has a valid SSL certificate.
Redirects 1 Number of domains that redirect to this domain.
Reverse IP 629 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

No crawl data available for this domain.

Last SSL certificate

No certificate data available for this domain.

DNS history

Last 5 redirect domains

Domain Last seen
motionarts.co.uk 11/14/2024

Reverse IP neighbours

88.222.222.62 306 domains · here since 9/25/2026
Domain On this IP since
zarmill.com 9/27/2026
yuvarlakcaybotanikgarden.com 9/27/2026
youglowmovement.com 9/27/2026
xfitnessfreaks.com 10/3/2026
wwwshopbefore.de 9/29/2026
wehauljunkremoval.org 9/27/2026
vnbrkl.com 10/1/2026
virinflow.com 10/1/2026
villabourdon.com 10/4/2026
vikasit.com 9/29/2026
vente-genay.fr 9/27/2026
velourblanc.fr 9/24/2026
and 293 more
2.57.91.64 293 domains · here since 9/25/2026
Domain On this IP since
zatiermakert.com 9/22/2026
zaltysdesign.lt 10/5/2026
yourbusinessstartnow.online 9/28/2026
yd-properties.com 9/26/2026
yaadville.store 10/3/2026
xn--bergues-fwa.cat 9/30/2026
xn--220bx6b87w75awyg2ik0tiln.com 10/4/2026
xclusivebeautybrands.fun 10/2/2026
woxwer.co.nz 10/3/2026
wirefireftc.com 9/27/2026
weportmedicalpharmacy.com 10/3/2026
wellnessevo.it 10/1/2026
and 280 more
2a02:4780:84:4dd0:86b8:8146:6160:cd47 15 domains · here since 9/25/2026
Domain On this IP since
wisermentoring.com 9/25/2026
wiragardasejahtera.com 9/25/2026
trvlamerica.com 9/25/2026
nosassessoria.com.br 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more
2a02:4780:84:a53d:b46d:ab13:5984:7d1 15 domains · here since 9/25/2026
Domain On this IP since
wisermentoring.com 9/25/2026
wiragardasejahtera.com 9/25/2026
trvlamerica.com 9/25/2026
nosassessoria.com.br 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more

Sharing an address does not always mean sharing a server: on a CDN or a large hosting platform, millions of unrelated domains answer on the same few addresses. We measured how far that goes in Half the web sits on 276 IP addresses.