Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.3 M

Registered domains

9.2 M

New domains in the last 30 days

65.0 M

Social media profiles detected

trvlamerica.com

trvlamerica.com serves a website of its own. It answers on both IPv4 and IPv6, with no TLS certificate and MX records for mail.

643 other domains share an IP address with it.

The most recent crawl returned the page title “Parked Domain name on Hostinger DNS system” and 32,079 bytes of HTML.

Domain properties

Property Value Explanation
First seen unknown Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record yes The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https no The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate no certificate Shows whether the domain has a valid SSL certificate.
Redirects 0 Number of domains that redirect to this domain.
Reverse IP 643 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

Title Parked Domain name on Hostinger DNS system
Description (not set)
Content-Length 32,079 bytes

Title and description as published by the page itself in its own <title> and <meta name="description"> tags.

Last SSL certificate

No certificate data available for this domain.

DNS history

IPv4 address Last updated
84.32.84.38 9/29/2026
88.222.222.188 9/29/2026
2.57.91.253 9/21/2026
84.32.84.225 9/21/2026
2.57.91.248 9/13/2026
IPv6 address Last updated
2a02:4780:84:9aa5:54b4:8371:9d1b:eff9 9/29/2026
2a02:4780:84:ac90:4638:984:12b7:a5ee 9/29/2026
2a02:4780:84:a060:83c0:9cea:9e2d:ed17 9/21/2026
2a02:4780:84:ded9:e4ad:3db5:517e:61a7 9/21/2026
2a02:4780:84:871a:f29e:f15d:b2e4:612e 9/13/2026
Mail server Priority Last updated
mx1.hostinger.com 5 4/28/2025
mx2.hostinger.com 10 4/28/2025
Name server Last updated
ns1.dns-parking.com 4/28/2025
ns2.dns-parking.com 4/28/2025

Last 5 redirect domains

No domains found.

Reverse IP neighbours

2.57.91.209 376 domains · here since 9/25/2026
Domain On this IP since
zocial.pe 9/28/2026
yuvrino.com 9/30/2026
yourjolie.com 9/26/2026
yesrepresentacao.com.br 9/30/2026
xn--soluesfingd-p9a6p.shop 9/22/2026
worldit.com.mx 10/3/2026
workwiththadeus.com 9/24/2026
wiragardasejahtera.com 9/25/2026
wintenterprise.biz 9/24/2026
whyteswellness.com 9/24/2026
webdesignepro.shop 9/23/2026
vurgerecovery.com 9/29/2026
and 363 more
88.222.222.245 237 domains · here since 9/25/2026
Domain On this IP since
zackyost.com 9/24/2026
yunusemreunlubeyazesyaservisi-ankara.com 9/24/2026
witoldprokopczyk.com 9/25/2026
wiragardasejahtera.com 9/25/2026
whitelabelly.com 10/1/2026
warymusicproject.fr 10/1/2026
wapjar.fun 9/24/2026
wangikalensari.com 9/23/2026
vn500pg.live 9/25/2026
vidaoutdoorblog.com 9/24/2026
vibevogue.co.uk 9/26/2026
vedalifespace.com 9/23/2026
and 224 more
2a02:4780:84:4dd0:86b8:8146:6160:cd47 15 domains · here since 9/25/2026
Domain On this IP since
wisermentoring.com 9/25/2026
wiragardasejahtera.com 9/25/2026
nosassessoria.com.br 9/25/2026
motionyoga.co.uk 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more
2a02:4780:84:a53d:b46d:ab13:5984:7d1 15 domains · here since 9/25/2026
Domain On this IP since
wisermentoring.com 9/25/2026
wiragardasejahtera.com 9/25/2026
nosassessoria.com.br 9/25/2026
motionyoga.co.uk 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more

Sharing an address does not always mean sharing a server: on a CDN or a large hosting platform, millions of unrelated domains answer on the same few addresses. We measured how far that goes in Half the web sits on 276 IP addresses.