Dive into our data, search now!

We offer robust APIs and data services for domainers, data crawlers, security teams and many more.

382.3 M

Registered domains

9.2 M

New domains in the last 30 days

65.3 M

Social media profiles detected

wisermentoring.com

wisermentoring.com serves a website of its own. It answers on both IPv4 and IPv6, with no TLS certificate and MX records for mail.

597 other domains share an IP address with it.

The most recent crawl returned the page title “Checking your browser before accessing. Just a moment...” and 6,192 bytes of HTML. webXtrend first recorded it on .

Domain properties

Property Value Explanation
First seen 10/19/2018 Date the domain was first seen.
Has website yes A website is hosted under the domain, which does not redirect to an external domain.
Has MX-record yes The domain has an MX record.
External redirect no The domain redirects to another domain.
Redirect to https no The domain redirects to https.
Redirect to www. no The domain redirects to www.domain.
Only with www. no The domain can only be reached with the subdomain "www".
Only DNS, no website no There are no A or AAAA records in DNS.
IP-Address Both Shows whether the domain only has IPv4 or IPv6 or both.
SSL-Certificate no certificate Shows whether the domain has a valid SSL certificate.
Redirects 0 Number of domains that redirect to this domain.
Reverse IP 597 Number of domains with the same IP(s).

Detected social media networks

No social networks found on this website.

Last successful crawl

Title Checking your browser before accessing. Just a moment...
Description (not set)
Content-Length 6,192 bytes

Title and description as published by the page itself in its own <title> and <meta name="description"> tags.

Last SSL certificate

No certificate data available for this domain.

DNS history

IPv4 address Last updated
2.57.91.205 9/28/2026
84.32.84.102 9/28/2026
15.197.148.33 12/10/2023
3.33.130.190 12/10/2023
IPv6 address Last updated
2a02:4780:84:8226:cbe1:66df:a38c:f244 9/28/2026
2a02:4780:84:d306:c88c:b255:9397:8040 9/28/2026
Mail server Priority Last updated
mx1.hostinger.com 5 9/28/2026
mx2.hostinger.com 10 9/28/2026
Name server Last updated
artemis.dns-parking.com 9/28/2026
hermes.dns-parking.com 9/28/2026
ns27.domaincontrol.com 12/10/2023
ns28.domaincontrol.com 12/10/2023

Last 5 redirect domains

No domains found.

Reverse IP neighbours

2.57.91.175 298 domains · here since 9/25/2026
Domain On this IP since
ztennis.eu 9/22/2026
yugubet.com 9/27/2026
youronlineoandm.com 9/29/2026
ylja.be 9/30/2026
yesyourenglishspecialist.it 9/28/2026
yantratattooindia.com 9/28/2026
xnia.ai 10/1/2026
xn--boissacr-i1a.com 9/25/2026
wyaccounting.com 10/1/2026
wonderboundmedia.com 9/27/2026
wiserootsrising.com 9/26/2026
wisdominaction.ag 10/2/2026
and 285 more
84.32.84.200 269 domains · here since 9/25/2026
Domain On this IP since
ztmhomesense.com 10/2/2026
zmzradio.com 9/25/2026
zapveiculos.com 9/26/2026
youprintgallery.com 9/19/2026
youngwakhan.com 9/25/2026
yongstere.com.br 9/25/2026
xn--boissacr-i1a.com 9/25/2026
wisefruits.com 9/28/2026
wigglyroads.com 9/27/2026
wellspringbooks.shop 9/30/2026
wavesbaseballandsoftball.com 9/22/2026
walterappliancesrepair.co.za 9/30/2026
and 256 more
2a02:4780:84:4dd0:86b8:8146:6160:cd47 15 domains · here since 9/25/2026
Domain On this IP since
wiragardasejahtera.com 9/25/2026
trvlamerica.com 9/25/2026
nosassessoria.com.br 9/25/2026
motionyoga.co.uk 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more
2a02:4780:84:a53d:b46d:ab13:5984:7d1 15 domains · here since 9/25/2026
Domain On this IP since
wiragardasejahtera.com 9/25/2026
trvlamerica.com 9/25/2026
nosassessoria.com.br 9/25/2026
motionyoga.co.uk 9/25/2026
mesopotamiawatch.com 9/25/2026
lanternchimneysweepservice.site 9/25/2026
guagenciacreativa.com 9/25/2026
grillwizz-de.de 9/25/2026
glispata.com 9/25/2026
digiwebcompagny.com 9/25/2026
blacksteeltrailers.store 9/25/2026
aqualabinternational.com 9/25/2026
and 2 more

Sharing an address does not always mean sharing a server: on a CDN or a large hosting platform, millions of unrelated domains answer on the same few addresses. We measured how far that goes in Half the web sits on 276 IP addresses.